PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00019658-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 369aa    MW: 40825.5 Da    PI: 9.8944
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00019658-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR183.82.8e-2631116291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                            +Y+eYAk+vGF + k +s++s+ ++e+++++f C ++g++++++++     ++r++ ++gCka+++vk++ +gkw+++++++eHnHel
  SMil_00019658-RA_Salv  31 YYKEYAKSVGFGTAKLSSRRSRASKEFIDAKFSCIRYGNKQQSDDA----INPRPSPKIGCKASMHVKRRLSGKWYIHSFVKEHNHEL 114
                            8***************************************999877....9************************************9 PP

                   FAR1  90 ap 91 
                             p
  SMil_00019658-RA_Salv 115 LP 116
                            75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.8E-2431116IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MEASSSSVLV NSNLEPRDDL EFDTHEAAYA YYKEYAKSVG FGTAKLSSRR SRASKEFIDA  60
KFSCIRYGNK QQSDDAINPR PSPKIGCKAS MHVKRRLSGK WYIHSFVKEH NHELLPAQAH  120
FFRSHRIADS VNNDTKVRKK KVPASVLKQY GAYQHCIVVL QMSGVFSIPF KYILQRWTNA  180
ATSRIPLSEK LEEVQAKVRR YNDLCRRAII LGEEGSLSEE SYNNAVAAIN EALKHCTIVN  240
QPSNQNGLRP HVSAPLAILG VGGADHNVAM TSGQQVPTAK VIDTNKGSKR INSGKEAASN  300
GGITGKKGKV PLEPPITNIG THGIFQHMDM PGPLDYPALY PRFLTTLLKG GEMSKRGVEM  360
LGEMLEEQS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072522.11e-107PREDICTED: protein FAR1-RELATED SEQUENCE 4
RefseqXP_011072523.11e-107PREDICTED: protein FAR1-RELATED SEQUENCE 4
SwissprotQ6NQJ72e-63FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLA0A022Q4D21e-103A0A022Q4D2_ERYGU; Uncharacterized protein
STRINGSolyc03g121630.2.13e-78(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49621103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.16e-52FAR1-related sequence 4